| ￥1500 | |
| RP30026 | |
|
|
|
|
|
|
|
|
|
| Description |
This pool is
delivered in one pool of 53 peptides derived from a peptide scan (15mers with
11 aa overlap) through Spike glycoprotein - Receptor binding domain (mutation:
N501Y) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2)
for T cell assays (e.g. ELISPOT). |
| Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQ PTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF |
| Source |
Severe Acute
Respiratory Syndrome-related coronavirus 2 (Lineage B.1.1.7) Spike glycoprotein
- Receptor binding domain (covering the following mutation: N501Y). |
| Gene ID |
S |
| Length |
223 aa |
| Purity |
Crude (Major peak by
ESI-MS is guaranteed to be peptide of interest - determined at 220 nm for each
individual peptide). |
| Solubility | Dissolve in a minimum amount of pure DMSO (approx. 50 μl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
| Form | Lyophilized |
| Storage | Store at -20°C. |
| Note | The peptides of this product are supplied as trifluoroacetate salts. |
